PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011089860.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family Dof
Protein Properties Length: 291aa    MW: 31809.4 Da    PI: 8.0027
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011089860.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.86.6e-404099362
          zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                    e+alkcprCdstntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rkn+k+s
  XP_011089860.1 40 EQALKCPRCDSTNTKFCYYNNYSLSQPRYFCKSCRRYWTKGGTLRNVPVGGGCRKNNKRS 99
                    7899****************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-292897IPR003851Zinc finger, Dof-type
PfamPF027011.4E-334197IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4134397IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104581IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MPMDTSPAQP HNFQEMGSQT LESMFVCTKP QQEKKPRPAE QALKCPRCDS TNTKFCYYNN  60
YSLSQPRYFC KSCRRYWTKG GTLRNVPVGG GCRKNNKRSS SSSSSSTSSS SSSKRNHDHQ  120
PMPLTIPSPN VPPPFAPFSY DSANDLSLAI ARLQKQTAGQ LGFDEHDFPM PRTDVLGNFD  180
ALRVGFLDQT PRGLHNMYNY GVGDGINLGL ENGGMGLLGL EDLTNTSTAV KQEMCSSGRE  240
GESSSIGFWG FPWQSVGGDG NMHGELDSNR LSSWSGIGSS NLHGLLNSPL M
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011089860.10.0PREDICTED: dof zinc finger protein DOF3.2-like
TrEMBLA0A068UK675e-87A0A068UK67_COFCA; Uncharacterized protein
STRINGVIT_06s0004g03420.t015e-86(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28510.11e-39Dof family protein